PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J01940.1.p
Common NameEUGRSUZ_J01940, LOC104422407
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 303aa    MW: 33865.1 Da    PI: 9.6669
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J01940.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.12.6e-102874347
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                      +WT+ E + + +a + +  +   +W+++a++++ g+t ++++ ++q++
  Eucgr.J01940.1.p 28 KWTPAENKMFEKALAVHDQDtpdRWDRVASMIP-GKTVEDVVKHYQDL 74
                      8*****************99*************.************86 PP

2Myb_DNA-binding45.81.4e-14136180347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  Eucgr.J01940.1.p 136 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 180
                       8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512936.7532479IPR017884SANT domain
SMARTSM007175.4E-92577IPR001005SANT/Myb domain
SuperFamilySSF466895.89E-112574IPR009057Homeodomain-like
CDDcd001673.26E-82874No hitNo description
PfamPF002491.0E-82874IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-42872IPR009057Homeodomain-like
PROSITE profilePS5129420.728129185IPR017930Myb domain
SuperFamilySSF466896.88E-17130184IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-17132184IPR006447Myb domain, plants
SMARTSM007173.2E-13133183IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-12133180IPR009057Homeodomain-like
PfamPF002495.3E-13136180IPR001005SANT/Myb domain
CDDcd001671.42E-11136181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MKWETGVPLP PCASSANWFF NEDGRTAKWT PAENKMFEKA LAVHDQDTPD RWDRVASMIP  60
GKTVEDVVKH YQDLEVDVSN IEAGLIPIPG YSTTAPFTLE WANGHGYDGF KQSYGLGGKR  120
SSSIRPPEQE RKKGVPWTEE EHKLFLMGLK KYGKGDWRNI SRNFVITRTP TQVASHAQKY  180
FIRQLSGGKD KRRASIHDIT TVNLTETRTP SPDDKRPPSP DPSSMVARHP TPVTAPRTPF  240
LWNQPSNGGS MTFHATQGDM SMCPHFGVNS FGLKFQGQNT HRGTFIQNPV FHMQAGQSYP  300
HG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A8e-1929941176RADIALIS
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J01940.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010033026.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-137DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A059AFX80.0A0A059AFX8_EUCGR; Uncharacterized protein
STRINGPOPTR_0009s04730.11e-148(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-102Homeodomain-like transcriptional regulator